| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries) Uniprot P38501 |
| Domain d1as6a2: 1as6 A:167-339 [23091] Other proteins in same PDB: d1as6a1, d1as6b1, d1as6c1 complexed with cu, no2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1as6 (more details), 1.8 Å
SCOPe Domain Sequences for d1as6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1as6a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1as6a2:
View in 3DDomains from other chains: (mouse over for more information) d1as6b1, d1as6b2, d1as6c1, d1as6c2 |