Lineage for d2jd4b1 (2jd4 B:2685-2872)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781176Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 2781183Domain d2jd4b1: 2jd4 B:2685-2872 [230908]
    automated match to d1dyka1
    complexed with cl, mg

Details for d2jd4b1

PDB Entry: 2jd4 (more details), 1.9 Å

PDB Description: mouse laminin alpha1 chain, domains lg4-5
PDB Compounds: (B:) laminin subunit alpha-1

SCOPe Domain Sequences for d2jd4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd4b1 b.29.1.0 (B:2685-2872) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgliyyvahqn
qmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmtvdgqesp
svtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqldkdrplsa
savdrcyv

SCOPe Domain Coordinates for d2jd4b1:

Click to download the PDB-style file with coordinates for d2jd4b1.
(The format of our PDB-style files is described here.)

Timeline for d2jd4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jd4b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2jd4a1