Lineage for d2japd_ (2jap D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351219Species Streptomyces clavuligerus [TaxId:1901] [230898] (2 PDB entries)
  8. 1351226Domain d2japd_: 2jap D: [230906]
    automated match to d3l77a_
    complexed with j01, ndp

Details for d2japd_

PDB Entry: 2jap (more details), 2.1 Å

PDB Description: clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid
PDB Compounds: (D:) clavaldehyde dehydrogenase

SCOPe Domain Sequences for d2japd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2japd_ c.2.1.0 (D:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
salqgkvalitgassgigeataralaaegaavaiaarrveklralgdeltaagakvhvle
ldvadrqgvdaavastvealggldilvnnagimllgpvedadttdwtrmidtnllglmym
traalphllrskgtvvqmssiagrvnvrnaavyqatkfgvnafsetlrqevtergvrvvv
iepgttdtelrghithtatkemyeqrisqirklqaqdiaeavryavtaphhatvheifir
ptdqv

SCOPe Domain Coordinates for d2japd_:

Click to download the PDB-style file with coordinates for d2japd_.
(The format of our PDB-style files is described here.)

Timeline for d2japd_: