Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Streptomyces clavuligerus [TaxId:1901] [230898] (2 PDB entries) |
Domain d2japc_: 2jap C: [230905] automated match to d3l77a_ complexed with j01, ndp |
PDB Entry: 2jap (more details), 2.1 Å
SCOPe Domain Sequences for d2japc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2japc_ c.2.1.0 (C:) automated matches {Streptomyces clavuligerus [TaxId: 1901]} psalqgkvalitgassgigeataralaaegaavaiaarrveklralgdeltaagakvhvl eldvadrqgvdaavastvealggldilvnnagimllgpvedadttdwtrmidtnllglmy mtraalphllrskgtvvqmssiagrvnvrnaavyqatkfgvnafsetlrqevtergvrvv viepgttdtelrghithtatkemyeqrisqirklqaqdiaeavryavtaphhatvheifi rptdqv
Timeline for d2japc_: