Lineage for d2japc_ (2jap C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848659Species Streptomyces clavuligerus [TaxId:1901] [230898] (2 PDB entries)
  8. 2848666Domain d2japc_: 2jap C: [230905]
    automated match to d3l77a_
    complexed with j01, ndp

Details for d2japc_

PDB Entry: 2jap (more details), 2.1 Å

PDB Description: clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid
PDB Compounds: (C:) clavaldehyde dehydrogenase

SCOPe Domain Sequences for d2japc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2japc_ c.2.1.0 (C:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
psalqgkvalitgassgigeataralaaegaavaiaarrveklralgdeltaagakvhvl
eldvadrqgvdaavastvealggldilvnnagimllgpvedadttdwtrmidtnllglmy
mtraalphllrskgtvvqmssiagrvnvrnaavyqatkfgvnafsetlrqevtergvrvv
viepgttdtelrghithtatkemyeqrisqirklqaqdiaeavryavtaphhatvheifi
rptdqv

SCOPe Domain Coordinates for d2japc_:

Click to download the PDB-style file with coordinates for d2japc_.
(The format of our PDB-style files is described here.)

Timeline for d2japc_: