Lineage for d2j1pb_ (2j1p B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732278Species White mustard (Sinapis alba) [TaxId:3728] [230881] (1 PDB entry)
  8. 2732280Domain d2j1pb_: 2j1p B: [230883]
    automated match to d3oacd_
    complexed with bme, grg, pgo

Details for d2j1pb_

PDB Entry: 2j1p (more details), 1.8 Å

PDB Description: geranylgeranyl diphosphate synthase from sinapis alba in complex with ggpp
PDB Compounds: (B:) Geranylgeranyl pyrophosphate synthetase

SCOPe Domain Sequences for d2j1pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1pb_ a.128.1.0 (B:) automated matches {White mustard (Sinapis alba) [TaxId: 3728]}
dpisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvggee
slampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavlagdallsfafe
hlasatssevsparvvravgelakaigteglvagqvvdissegldlnnvglehlkfihlh
ktaalleasavlggiigggsdeeierlrkfarcigllfqvvddildvtksskltypklmg
leksrefaeklnteardqllgfdsdkvapllalanyi

SCOPe Domain Coordinates for d2j1pb_:

Click to download the PDB-style file with coordinates for d2j1pb_.
(The format of our PDB-style files is described here.)

Timeline for d2j1pb_: