Lineage for d2izze2 (2izz E:165-272)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276549Species Human (Homo sapiens) [TaxId:9606] [225061] (10 PDB entries)
  8. 1276554Domain d2izze2: 2izz E:165-272 [230880]
    Other proteins in same PDB: d2izza1, d2izzb1, d2izzc1, d2izzd1, d2izze1
    automated match to d2rcya2
    complexed with edo, nad

Details for d2izze2

PDB Entry: 2izz (more details), 1.95 Å

PDB Description: crystal structure of human pyrroline-5-carboxylate reductase
PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2izze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izze2 a.100.1.0 (E:165-272) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsma

SCOPe Domain Coordinates for d2izze2:

Click to download the PDB-style file with coordinates for d2izze2.
(The format of our PDB-style files is described here.)

Timeline for d2izze2: