Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
Domain d2izze2: 2izz E:165-272 [230880] Other proteins in same PDB: d2izza1, d2izza3, d2izzb1, d2izzb3, d2izzc1, d2izzc3, d2izzd1, d2izzd3, d2izze1 automated match to d2rcya2 complexed with edo, nad |
PDB Entry: 2izz (more details), 1.95 Å
SCOPe Domain Sequences for d2izze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izze2 a.100.1.0 (E:165-272) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsma
Timeline for d2izze2: