SCOPe 2.04: Domain d1ntda1: 1ntd A:5-166

Lineage for d1ntda1 (1ntd A:5-166)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
   Uniprot P38501

8. Domain d1ntda1: 1ntd A:5-166 [23088]
   complexed with cu; mutant

Details for d1ntda1

PDB Entry: 1ntd, 2.3 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1ntda1:

Sequence; same for both SEQRES and ATOM records:

>d1ntda1 b.6.1.3 (A:5-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgengaimvlpreglhdgk

Timeline for d1ntda1:

• d1ntda1 first appeared (with stable ids) in SCOP 1.55, called d1ntd_1
  
• d1ntda1 appears in SCOPe 2.03
  
• d1ntda1 appears in SCOPe 2.05
  
• d1ntda1 appears in the current release, SCOPe 2.08