Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d2izzc1: 2izz C:1-164 [230872] Other proteins in same PDB: d2izza2, d2izza3, d2izzb2, d2izzb3, d2izzc2, d2izzc3, d2izzd2, d2izzd3, d2izze2 automated match to d2rcyd1 complexed with edo, nad |
PDB Entry: 2izz (more details), 1.95 Å
SCOPe Domain Sequences for d2izzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izzc1 c.2.1.0 (C:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d2izzc1: