Lineage for d2izwb_ (2izw B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1563358Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1563905Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 1563906Protein automated matches [190988] (7 species)
    not a true protein
  7. 1563934Species Ryegrass mottle virus [TaxId:119910] [225341] (1 PDB entry)
  8. 1563936Domain d2izwb_: 2izw B: [230870]
    automated match to d2izwc_

Details for d2izwb_

PDB Entry: 2izw (more details), 2.9 Å

PDB Description: crystal structure of ryegrass mottle virus
PDB Compounds: (B:) ryegrass mottle virus coat protein

SCOPe Domain Sequences for d2izwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izwb_ b.121.4.0 (B:) automated matches {Ryegrass mottle virus [TaxId: 119910]}
tqygditpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvrya
hftwepivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpeh
aslpwylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq

SCOPe Domain Coordinates for d2izwb_:

Click to download the PDB-style file with coordinates for d2izwb_.
(The format of our PDB-style files is described here.)

Timeline for d2izwb_: