Lineage for d2afnc2 (2afn C:167-339)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11202Protein Nitrite reductase, NIR [49551] (3 species)
  7. 11226Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (9 PDB entries)
  8. 11244Domain d2afnc2: 2afn C:167-339 [23087]

Details for d2afnc2

PDB Entry: 2afn (more details), 2 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc

SCOP Domain Sequences for d2afnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afnc2 b.6.1.3 (C:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOP Domain Coordinates for d2afnc2:

Click to download the PDB-style file with coordinates for d2afnc2.
(The format of our PDB-style files is described here.)

Timeline for d2afnc2: