Lineage for d2izwa_ (2izw A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087343Species Ryegrass mottle virus [TaxId:119910] [225341] (1 PDB entry)
  8. 2087344Domain d2izwa_: 2izw A: [230869]
    automated match to d2izwc_

Details for d2izwa_

PDB Entry: 2izw (more details), 2.9 Å

PDB Description: crystal structure of ryegrass mottle virus
PDB Compounds: (A:) ryegrass mottle virus coat protein

SCOPe Domain Sequences for d2izwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izwa_ b.121.4.0 (A:) automated matches {Ryegrass mottle virus [TaxId: 119910]}
qygditpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvryah
ftwepivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpeha
slpwylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq

SCOPe Domain Coordinates for d2izwa_:

Click to download the PDB-style file with coordinates for d2izwa_.
(The format of our PDB-style files is described here.)

Timeline for d2izwa_: