Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (13 species) not a true protein |
Species Ryegrass mottle virus [TaxId:119910] [225341] (1 PDB entry) |
Domain d2izwa_: 2izw A: [230869] automated match to d2izwc_ |
PDB Entry: 2izw (more details), 2.9 Å
SCOPe Domain Sequences for d2izwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izwa_ b.121.4.0 (A:) automated matches {Ryegrass mottle virus [TaxId: 119910]} qygditpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvryah ftwepivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpeha slpwylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq
Timeline for d2izwa_: