Lineage for d2ivqj2 (2ivq J:87-156)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419690Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 1419691Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
    automatically mapped to Pfam PF02560
  5. 1419692Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 1419735Protein automated matches [230795] (1 species)
    not a true protein
  7. 1419736Species Escherichia coli [TaxId:562] [230796] (4 PDB entries)
  8. 1419772Domain d2ivqj2: 2ivq J:87-156 [230867]
    Other proteins in same PDB: d2ivqa1, d2ivqb1, d2ivqc1, d2ivqd1, d2ivqe1, d2ivqf1, d2ivqg1, d2ivqh1, d2ivqi1, d2ivqj1
    automated match to d1dwka2

Details for d2ivqj2

PDB Entry: 2ivq (more details), 2.1 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (J:) cyanate hydratase

SCOPe Domain Sequences for d2ivqj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivqj2 d.72.1.1 (J:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmykfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d2ivqj2:

Click to download the PDB-style file with coordinates for d2ivqj2.
(The format of our PDB-style files is described here.)

Timeline for d2ivqj2: