SCOPe 2.08: Domain d2ivqh2: 2ivq H:87-156

Lineage for d2ivqh2 (2ivq H:87-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
   active form is a decamer formed by five dimers

6. Protein automated matches [230795] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)

8. Domain d2ivqh2: 2ivq H:87-156 [230863]
   Other proteins in same PDB: d2ivqa1, d2ivqb1, d2ivqc1, d2ivqd1, d2ivqe1, d2ivqf1, d2ivqg1, d2ivqh1, d2ivqi1, d2ivqj1
   automated match to d1dwka2
   complexed with cl, so4

Details for d2ivqh2

PDB Entry: 2ivq, 2.1 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (H:) cyanate hydratase

SCOPe Domain Sequences for d2ivqh2:

Sequence; same for both SEQRES and ATOM records:

>d2ivqh2 d.72.1.1 (H:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmykfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

Timeline for d2ivqh2:

• d2ivqh2 first appeared in SCOPe 2.03
  
• d2ivqh2 appears in SCOPe 2.07