Lineage for d2ivqh1 (2ivq H:1-86)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709508Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins)
    probably does not bind to DNA
  6. 2709531Protein automated matches [230792] (1 species)
    not a true protein
  7. 2709532Species Escherichia coli [TaxId:562] [230793] (6 PDB entries)
  8. 2709590Domain d2ivqh1: 2ivq H:1-86 [230862]
    Other proteins in same PDB: d2ivqa2, d2ivqb2, d2ivqc2, d2ivqd2, d2ivqe2, d2ivqf2, d2ivqg2, d2ivqh2, d2ivqi2, d2ivqj2
    automated match to d1dwka1
    complexed with cl, so4

Details for d2ivqh1

PDB Entry: 2ivq (more details), 2.1 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (H:) cyanate hydratase

SCOPe Domain Sequences for d2ivqh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivqh1 a.35.1.4 (H:1-86) automated matches {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOPe Domain Coordinates for d2ivqh1:

Click to download the PDB-style file with coordinates for d2ivqh1.
(The format of our PDB-style files is described here.)

Timeline for d2ivqh1: