![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
![]() | Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) ![]() automatically mapped to Pfam PF02560 |
![]() | Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins) active form is a decamer formed by five dimers |
![]() | Protein automated matches [230795] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [230796] (6 PDB entries) |
![]() | Domain d2ivqg2: 2ivq G:87-156 [230861] Other proteins in same PDB: d2ivqa1, d2ivqb1, d2ivqc1, d2ivqd1, d2ivqe1, d2ivqf1, d2ivqg1, d2ivqh1, d2ivqi1, d2ivqj1 automated match to d1dwka2 complexed with cl, so4 |
PDB Entry: 2ivq (more details), 2.1 Å
SCOPe Domain Sequences for d2ivqg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivqg2 d.72.1.1 (G:87-156) automated matches {Escherichia coli [TaxId: 562]} riptdptmykfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl dgkylptkpf
Timeline for d2ivqg2: