Lineage for d2ivqc2 (2ivq C:87-156)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656576Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 1656577Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
    automatically mapped to Pfam PF02560
  5. 1656578Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 1656601Protein automated matches [230795] (1 species)
    not a true protein
  7. 1656602Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)
  8. 1656655Domain d2ivqc2: 2ivq C:87-156 [230857]
    Other proteins in same PDB: d2ivqa1, d2ivqb1, d2ivqc1, d2ivqd1, d2ivqe1, d2ivqf1, d2ivqg1, d2ivqh1, d2ivqi1, d2ivqj1
    automated match to d1dwka2
    complexed with cl, so4

Details for d2ivqc2

PDB Entry: 2ivq (more details), 2.1 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (C:) cyanate hydratase

SCOPe Domain Sequences for d2ivqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivqc2 d.72.1.1 (C:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmykfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d2ivqc2:

Click to download the PDB-style file with coordinates for d2ivqc2.
(The format of our PDB-style files is described here.)

Timeline for d2ivqc2: