Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins) probably does not bind to DNA |
Protein automated matches [230792] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [230793] (6 PDB entries) |
Domain d2ivqa1: 2ivq A:1-86 [230850] Other proteins in same PDB: d2ivqa2, d2ivqb2, d2ivqc2, d2ivqd2, d2ivqe2, d2ivqf2, d2ivqg2, d2ivqh2, d2ivqi2, d2ivqj2 automated match to d1dwka1 complexed with cl, so4 |
PDB Entry: 2ivq (more details), 2.1 Å
SCOPe Domain Sequences for d2ivqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivqa1 a.35.1.4 (A:1-86) automated matches {Escherichia coli [TaxId: 562]} miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl vgakldldedsilllqmiplrgcidd
Timeline for d2ivqa1: