Lineage for d2ivgf1 (2ivg F:1-86)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322693Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins)
    probably does not bind to DNA
  6. 2322716Protein automated matches [230792] (1 species)
    not a true protein
  7. 2322717Species Escherichia coli [TaxId:562] [230793] (6 PDB entries)
  8. 2322743Domain d2ivgf1: 2ivg F:1-86 [230842]
    Other proteins in same PDB: d2ivga2, d2ivgb2, d2ivgc2, d2ivgd2, d2ivge2, d2ivgf2, d2ivgg2, d2ivgh2, d2ivgi2, d2ivgj2
    automated match to d1dwka1
    complexed with azi, cl, so4

Details for d2ivgf1

PDB Entry: 2ivg (more details), 1.87 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (F:) cyanate lyase

SCOPe Domain Sequences for d2ivgf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivgf1 a.35.1.4 (F:1-86) automated matches {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOPe Domain Coordinates for d2ivgf1:

Click to download the PDB-style file with coordinates for d2ivgf1.
(The format of our PDB-style files is described here.)

Timeline for d2ivgf1: