Lineage for d2ivbe2 (2ivb E:87-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564270Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2564271Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2564272Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 2564295Protein automated matches [230795] (1 species)
    not a true protein
  7. 2564296Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)
  8. 2564331Domain d2ivbe2: 2ivb E:87-156 [230827]
    Other proteins in same PDB: d2ivba1, d2ivbb1, d2ivbc1, d2ivbd1, d2ivbe1, d2ivbf1, d2ivbg1, d2ivbh1, d2ivbi1, d2ivbj1
    automated match to d1dwka2
    complexed with azi, cl, so4

Details for d2ivbe2

PDB Entry: 2ivb (more details), 1.95 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (E:) cyanate hydratase

SCOPe Domain Sequences for d2ivbe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivbe2 d.72.1.1 (E:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiiaainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d2ivbe2:

Click to download the PDB-style file with coordinates for d2ivbe2.
(The format of our PDB-style files is described here.)

Timeline for d2ivbe2: