SCOP 1.67: Domain d2afna1: 2afn A:9-166

Lineage for d2afna1 (2afn A:9-166)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (21 PDB entries)

8. Domain d2afna1: 2afn A:9-166 [23082]

Details for d2afna1

PDB Entry: 2afn, 2 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc

SCOP Domain Sequences for d2afna1:

Sequence; same for both SEQRES and ATOM records:

>d2afna1 b.6.1.3 (A:9-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

Timeline for d2afna1:

• d2afna1 first appeared (with stable ids) in SCOP 1.55
  
• d2afna1 appears in SCOP 1.65
  
• d2afna1 appears in SCOP 1.69
  
• d2afna1 appears in the current release, SCOPe 2.08