SCOP 1.73: Domain d1et5a2: 1et5 A:167-339

Lineage for d1et5a2 (1et5 A:167-339)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries)

8. Domain d1et5a2: 1et5 A:167-339 [23081]
   complexed with cu, zn; mutant

Details for d1et5a2

PDB Entry: 1et5, 1.9 Å

PDB Description: crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6

PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1et5a2:

Sequence; same for both SEQRES and ATOM records:

>d1et5a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1et5a2:

• d1et5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1et5a2 appears in SCOP 1.71
  
• d1et5a2 appears in SCOP 1.75
  
• d1et5a2 appears in the current release, SCOPe 2.08