Lineage for d1et5a2 (1et5 A:167-339)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries)
    Uniprot P38501
  8. Domain d1et5a2: 1et5 A:167-339 [23081]
    Other proteins in same PDB: d1et5a1
    complexed with cu, zn; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1et5a2

PDB Entry: 1et5 (more details), 1.9 Å

PDB Description: crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1et5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1et5a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOPe Domain Coordinates for d1et5a2 are not available.

Timeline for d1et5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et5a1