SCOPe 2.06: Domain d2iv1e1: 2iv1 E:1-86

Lineage for d2iv1e1 (2iv1 E:1-86)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins)
   probably does not bind to DNA

6. Protein automated matches [230792] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [230793] (6 PDB entries)

8. Domain d2iv1e1: 2iv1 E:1-86 [230807]
   Other proteins in same PDB: d2iv1a2, d2iv1b2, d2iv1c2, d2iv1d2, d2iv1e2, d2iv1f2, d2iv1g2, d2iv1h2, d2iv1i2, d2iv1j2
   automated match to d1dwka1
   complexed with cl, so4

Details for d2iv1e1

PDB Entry: 2iv1, 1.88 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (E:) cyanate hydratase

SCOPe Domain Sequences for d2iv1e1:

Sequence; same for both SEQRES and ATOM records:

>d2iv1e1 a.35.1.4 (E:1-86) automated matches {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

Timeline for d2iv1e1:

• d2iv1e1 first appeared in SCOPe 2.03
  
• d2iv1e1 appears in SCOPe 2.05
  
• d2iv1e1 appears in SCOPe 2.07
  
• d2iv1e1 appears in the current release, SCOPe 2.08