Lineage for d2iv1g1 (2iv1 G:1-86)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268232Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins)
    probably does not bind to DNA
  6. 1268275Protein automated matches [230792] (1 species)
    not a true protein
  7. 1268276Species Escherichia coli [TaxId:562] [230793] (4 PDB entries)
  8. 1268283Domain d2iv1g1: 2iv1 G:1-86 [230806]
    Other proteins in same PDB: d2iv1a2, d2iv1b2, d2iv1c2, d2iv1d2, d2iv1e2, d2iv1f2, d2iv1g2, d2iv1h2, d2iv1i2, d2iv1j2
    automated match to d1dwka1

Details for d2iv1g1

PDB Entry: 2iv1 (more details), 1.88 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (G:) cyanate hydratase

SCOPe Domain Sequences for d2iv1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv1g1 a.35.1.4 (G:1-86) automated matches {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOPe Domain Coordinates for d2iv1g1:

Click to download the PDB-style file with coordinates for d2iv1g1.
(The format of our PDB-style files is described here.)

Timeline for d2iv1g1: