SCOPe 2.05: Domain d2iv1d2: 2iv1 D:87-156

Lineage for d2iv1d2 (2iv1 D:87-156)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
   active form is a decamer formed by five dimers

6. Protein automated matches [230795] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)

8. Domain d2iv1d2: 2iv1 D:87-156 [230803]
   Other proteins in same PDB: d2iv1a1, d2iv1b1, d2iv1c1, d2iv1d1, d2iv1e1, d2iv1f1, d2iv1g1, d2iv1h1, d2iv1i1, d2iv1j1
   automated match to d1dwka2
   complexed with cl, so4

Details for d2iv1d2

PDB Entry: 2iv1, 1.88 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (D:) cyanate hydratase

SCOPe Domain Sequences for d2iv1d2:

Sequence; same for both SEQRES and ATOM records:

>d2iv1d2 d.72.1.1 (D:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyqfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

Timeline for d2iv1d2:

• d2iv1d2 first appeared in SCOPe 2.03
  
• d2iv1d2 appears in SCOPe 2.04
  
• d2iv1d2 appears in SCOPe 2.06
  
• d2iv1d2 appears in the current release, SCOPe 2.08