| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins) probably does not bind to DNA |
| Protein automated matches [230792] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [230793] (6 PDB entries) |
| Domain d2iv1c1: 2iv1 C:1-86 [230800] Other proteins in same PDB: d2iv1a2, d2iv1b2, d2iv1c2, d2iv1d2, d2iv1e2, d2iv1f2, d2iv1g2, d2iv1h2, d2iv1i2, d2iv1j2 automated match to d1dwka1 complexed with cl, so4 |
PDB Entry: 2iv1 (more details), 1.88 Å
SCOPe Domain Sequences for d2iv1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iv1c1 a.35.1.4 (C:1-86) automated matches {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd
Timeline for d2iv1c1: