Lineage for d2iuka2 (2iuk A:176-864)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008082Family a.119.1.1: Plant lipoxigenases [48485] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008115Protein automated matches [226915] (1 species)
    not a true protein
  7. 2008116Species Soybean (Glycine max) [TaxId:3847] [225162] (2 PDB entries)
  8. 2008118Domain d2iuka2: 2iuk A:176-864 [230791]
    Other proteins in same PDB: d2iuka1, d2iukb1
    automated match to d1rrha1
    complexed with fe

Details for d2iuka2

PDB Entry: 2iuk (more details), 2.4 Å

PDB Description: Crystal structure of Soybean Lipoxygenase-D
PDB Compounds: (A:) seed lipoxygenase

SCOPe Domain Sequences for d2iuka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iuka2 a.119.1.1 (A:176-864) automated matches {Soybean (Glycine max) [TaxId: 3847]}
lpsatpapllkyrkeefevlrgdgtgkrkdfdriydydvyndlgnpdggdprpilggcsi
ypyplrvrtgrertrtdpnsekpgevyvprdenfghlkssdfltygikslshdviplfks
aifqlrvtssefesfedvrslyeggiklptdilsqisplpalkeifrtdgenvlqfppph
vakvsksgvmtdeefareviagvnpnvirrlqefppkstldptlygdqtstitkeqlein
mggvtveealstqrlfildyqdafipyltrinslptakayatrtilflkddgtlkplaie
lskphpdgdnlgpesivvlpategvdstiwllakahvivndsgyhqlvshwlnthavmep
faiatnrhlsvlhpiykllyphyrdtininglarqslinadgiieksflpgkysiemsss
vyknwvfthqalpadlvkrglaiedpsaphglrlviedypyavdgleiwdaiktwvheyv
slyyptdaavqqdtelqawwkeavekghgdlkekpwwpkkqttedliqscsiivwtasal
haavnfgqypygglilnrptlarrfipaegtpeydemvknpqkaylrtitpkfetlidls
vieilsrhasdeiylgeretpnwttdkkaleafkrfgskltgiegkinarnsdpslrnrt
gpvqlpytllhrsseegltfkgipnsisi

SCOPe Domain Coordinates for d2iuka2:

Click to download the PDB-style file with coordinates for d2iuka2.
(The format of our PDB-style files is described here.)

Timeline for d2iuka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iuka1