Lineage for d2iukb1 (2iuk B:1008-1175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773710Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2773711Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2773794Family b.12.1.0: automated matches [227174] (1 protein)
    not a true family
  6. 2773795Protein automated matches [226891] (5 species)
    not a true protein
  7. 2773816Species Soybean (Glycine max) [TaxId:3847] [225161] (2 PDB entries)
  8. 2773819Domain d2iukb1: 2iuk B:1008-1175 [230788]
    Other proteins in same PDB: d2iuka2, d2iukb2
    automated match to d1n8qa2
    complexed with fe

Details for d2iukb1

PDB Entry: 2iuk (more details), 2.4 Å

PDB Description: crystal structure of soybean lipoxygenase-d
PDB Compounds: (B:) seed lipoxygenase

SCOPe Domain Sequences for d2iukb1:

Sequence, based on SEQRES records: (download)

>d2iukb1 b.12.1.0 (B:1008-1175) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gqkikgtvvlmpknvldfnaitsigkggvidtatgilgqgvslvggvidtatsflgrnis
mqlisatqtdgsgngkvgkevylekhlptlptlgarqdafsiffewdasfgipgafyikn
fmtdefflvsvkledipnhgtiefvcnswvynfrsykknriffvndty

Sequence, based on observed residues (ATOM records): (download)

>d2iukb1 b.12.1.0 (B:1008-1175) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gqkikgtvvlmpknvldfnaitsividtatsflgrnismqlisatqtdgsgngkvgkevy
lekhlptlptlgarqdafsiffewdasfgipgafyiknfmtdefflvsvkledipnhgti
efvcnswvynfrsykknriffvndty

SCOPe Domain Coordinates for d2iukb1:

Click to download the PDB-style file with coordinates for d2iukb1.
(The format of our PDB-style files is described here.)

Timeline for d2iukb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iukb2