Lineage for d2ihbb_ (2ihb B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002317Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2002318Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2002379Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2002380Protein automated matches [190464] (3 species)
    not a true protein
  7. 2002384Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2002400Domain d2ihbb_: 2ihb B: [230787]
    automated match to d1emua_
    complexed with alf, gdp, mg

Details for d2ihbb_

PDB Entry: 2ihb (more details), 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
PDB Compounds: (B:) Regulator of G-protein signalling 10

SCOPe Domain Sequences for d2ihbb_:

Sequence, based on SEQRES records: (download)

>d2ihbb_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmqekak
eiymtflsskassqvnvegqsrlnekileephplmfqklqdqifnlmkydsysrflksdl
fl

Sequence, based on observed residues (ATOM records): (download)

>d2ihbb_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmqekak
eiymtflsskassqvnvegphplmfqklqdqifnlmkydsysrflksdlfl

SCOPe Domain Coordinates for d2ihbb_:

Click to download the PDB-style file with coordinates for d2ihbb_.
(The format of our PDB-style files is described here.)

Timeline for d2ihbb_: