Class a: All alpha proteins [46456] (290 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
Protein automated matches [190464] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) |
Domain d2ihbb_: 2ihb B: [230787] automated match to d1emua_ complexed with alf, gdp, mg |
PDB Entry: 2ihb (more details), 2.71 Å
SCOPe Domain Sequences for d2ihbb_:
Sequence, based on SEQRES records: (download)
>d2ihbb_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmqekak eiymtflsskassqvnvegqsrlnekileephplmfqklqdqifnlmkydsysrflksdl fl
>d2ihbb_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmqekak eiymtflsskassqvnvegphplmfqklqdqifnlmkydsysrflksdlfl
Timeline for d2ihbb_: