Lineage for d2iaga_ (2iag A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1744326Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1744327Protein automated matches [190847] (45 species)
    not a true protein
  7. 1744362Species Human (Homo sapiens) [TaxId:9606] [196470] (29 PDB entries)
  8. 1744402Domain d2iaga_: 2iag A: [230785]
    automated match to d3b99a_
    complexed with hem, na

Details for d2iaga_

PDB Entry: 2iag (more details), 2.15 Å

PDB Description: Crystal structure of human prostacyclin synthase
PDB Compounds: (A:) Prostacyclin synthase

SCOPe Domain Sequences for d2iaga_:

Sequence, based on SEQRES records: (download)

>d2iaga_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqaeq
pvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdr
lllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhcl
grsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirph

Sequence, based on observed residues (ATOM records): (download)

>d2iaga_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqttl
pqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpfls
pqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavns
ikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirph

SCOPe Domain Coordinates for d2iaga_:

Click to download the PDB-style file with coordinates for d2iaga_.
(The format of our PDB-style files is described here.)

Timeline for d2iaga_: