Lineage for d2i9pb2 (2i9p B:202-335)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721737Domain d2i9pb2: 2i9p B:202-335 [230784]
    Other proteins in same PDB: d2i9pa1, d2i9pa3, d2i9pb1, d2i9pb3, d2i9pc1, d2i9pc3, d2i9pd1, d2i9pd3
    automated match to d2i9pd2
    complexed with nad

Details for d2i9pb2

PDB Entry: 2i9p (more details), 2.55 Å

PDB Description: crystal structure of human hydroxyisobutyrate dehydrogenase complexed with nad+
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2i9pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9pb2 a.100.1.0 (B:202-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflreeet

SCOPe Domain Coordinates for d2i9pb2:

Click to download the PDB-style file with coordinates for d2i9pb2.
(The format of our PDB-style files is described here.)

Timeline for d2i9pb2: