Lineage for d2i9pb1 (2i9p B:41-201)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847246Domain d2i9pb1: 2i9p B:41-201 [230783]
    Other proteins in same PDB: d2i9pa2, d2i9pa3, d2i9pb2, d2i9pb3, d2i9pc2, d2i9pc3, d2i9pd2, d2i9pd3
    automated match to d2i9pd1
    complexed with nad

Details for d2i9pb1

PDB Entry: 2i9p (more details), 2.55 Å

PDB Description: crystal structure of human hydroxyisobutyrate dehydrogenase complexed with nad+
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2i9pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9pb1 c.2.1.0 (B:41-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadrii
tmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapvs
ggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycga

SCOPe Domain Coordinates for d2i9pb1:

Click to download the PDB-style file with coordinates for d2i9pb1.
(The format of our PDB-style files is described here.)

Timeline for d2i9pb1: