Lineage for d2hwva1 (2hwv A:134-232)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695337Species Enterococcus faecalis [TaxId:226185] [230777] (1 PDB entry)
  8. 2695338Domain d2hwva1: 2hwv A:134-232 [230778]
    Other proteins in same PDB: d2hwva2
    automated match to d2pmub_
    complexed with so4

Details for d2hwva1

PDB Entry: 2hwv (more details), 1.9 Å

PDB Description: crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
PDB Compounds: (A:) DNA-binding response regulator VicR

SCOPe Domain Sequences for d2hwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwva1 a.4.6.0 (A:134-232) automated matches {Enterococcus faecalis [TaxId: 226185]}
mtigdltihpdaymvskrgekielthrefellyylakhigqvmtrehllqtvwgydyfgd
vrtvdvtvrrlrekiedspshptylvtrrgvgyylrnpe

SCOPe Domain Coordinates for d2hwva1:

Click to download the PDB-style file with coordinates for d2hwva1.
(The format of our PDB-style files is described here.)

Timeline for d2hwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hwva2