| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
| Protein automated matches [190858] (25 species) not a true protein |
| Species Enterococcus faecalis [TaxId:226185] [230777] (1 PDB entry) |
| Domain d2hwva1: 2hwv A:134-232 [230778] Other proteins in same PDB: d2hwva2 automated match to d2pmub_ complexed with so4 |
PDB Entry: 2hwv (more details), 1.9 Å
SCOPe Domain Sequences for d2hwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hwva1 a.4.6.0 (A:134-232) automated matches {Enterococcus faecalis [TaxId: 226185]}
mtigdltihpdaymvskrgekielthrefellyylakhigqvmtrehllqtvwgydyfgd
vrtvdvtvrrlrekiedspshptylvtrrgvgyylrnpe
Timeline for d2hwva1: