![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225745] (8 PDB entries) |
![]() | Domain d2huza_: 2huz A: [230775] automated match to d4ag7a_ |
PDB Entry: 2huz (more details), 2.67 Å
SCOPe Domain Sequences for d2huza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huza_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf lk
Timeline for d2huza_: