![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily) unusual fold, made of four helices and four 2-3 stranded beta-sheets |
![]() | Superfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) ![]() automatically mapped to Pfam PF12229 |
![]() | Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (1 protein) |
![]() | Protein L,D-transpeptidase, pre-catalytic domain [143987] (1 species) |
![]() | Species Enterococcus faecium [TaxId:1352] [143988] (2 PDB entries) Uniprot Q3Y185 217-338 |
![]() | Domain d2hklc1: 2hkl C:217-338 [230770] Other proteins in same PDB: d2hkla2, d2hklb2, d2hklc2 automated match to d1zata2 complexed with so4; mutant |
PDB Entry: 2hkl (more details), 2.6 Å
SCOPe Domain Sequences for d2hklc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hklc1 d.335.1.1 (C:217-338) L,D-transpeptidase, pre-catalytic domain {Enterococcus faecium [TaxId: 1352]} keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad hp
Timeline for d2hklc1:
![]() Domains from other chains: (mouse over for more information) d2hkla1, d2hkla2, d2hklb1, d2hklb2 |