Lineage for d2hklc1 (2hkl C:217-338)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily)
    unusual fold, made of four helices and four 2-3 stranded beta-sheets
  4. Superfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) (S)
    automatically mapped to Pfam PF12229
  5. Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (2 proteins)
  6. Protein L,D-transpeptidase, pre-catalytic domain [143987] (1 species)
  7. Species Enterococcus faecium [TaxId:1352] [143988] (2 PDB entries)
    Uniprot Q3Y185 217-338
  8. Domain d2hklc1: 2hkl C:217-338 [230770]
    Other proteins in same PDB: d2hkla2, d2hklb2, d2hklc2
    automated match to d1zata2
    complexed with so4; mutant

Details for d2hklc1

PDB Entry: 2hkl (more details), 2.6 Å

PDB Description: Crystal structure of Enterococcus faecium L,D-transpeptidase C442S mutant
PDB Compounds: (C:) L,D-transpeptidase

SCOPe Domain Sequences for d2hklc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hklc1 d.335.1.1 (C:217-338) L,D-transpeptidase, pre-catalytic domain {Enterococcus faecium [TaxId: 1352]}
keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
hp

SCOPe Domain Coordinates for d2hklc1 are not available.

Timeline for d2hklc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hklc2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hkla1, d2hkla2, d2hklb1, d2hklb2