SCOPe 2.04: Domain d2hkla2: 2hkl A:339-466

Lineage for d2hkla2 (2hkl A:339-466)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family)
   automatically mapped to Pfam PF03734

5. Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
   Pfam PF03734; ErfK/YbiS/YcfS/YnhG

6. Protein L,D-transpeptidase, C-terminal, catalytic domain [141525] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [141526] (2 PDB entries)
   Uniprot Q3Y185 339-466

8. Domain d2hkla2: 2hkl A:339-466 [230767]
   Other proteins in same PDB: d2hkla1, d2hklb1, d2hklc1
   automated match to d1zata1
   complexed with so4; mutant

Details for d2hkla2

PDB Entry: 2hkl, 2.6 Å

PDB Description: crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant

PDB Compounds: (A:) L,D-transpeptidase

SCOPe Domain Sequences for d2hkla2:

Sequence, based on SEQRES records:

>d2hkla2 b.160.1.1 (A:339-466) L,D-transpeptidase, C-terminal, catalytic domain {Enterococcus faecium [TaxId: 1352]}
liedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgtnd
dgtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgmve
kgtpvlvf

Sequence, based on observed residues (ATOM records):

>d2hkla2 b.160.1.1 (A:339-466) L,D-transpeptidase, C-terminal, catalytic domain {Enterococcus faecium [TaxId: 1352]}
liedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgtng
tpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgmvekg
tpvlvf

Timeline for d2hkla2:

• d2hkla2 first appeared in SCOPe 2.03
  
• d2hkla2 appears in SCOPe 2.05
  
• d2hkla2 appears in the current release, SCOPe 2.08