Lineage for d2hjva_ (2hjv A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1597963Species Bacillus subtilis [TaxId:1423] [230763] (2 PDB entries)
  8. 1597964Domain d2hjva_: 2hjv A: [230765]
    automated match to d2rb4a_

Details for d2hjva_

PDB Entry: 2hjv (more details), 1.95 Å

PDB Description: Structure of the second domain (residues 207-368) of the Bacillus subtilis YxiN protein
PDB Compounds: (A:) ATP-dependent RNA helicase dbpA

SCOPe Domain Sequences for d2hjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjva_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
ttrniehaviqvreenkfsllkdvlmtenpdsciifcrtkehvnqltdelddlgypcdki
hggmiqedrfdvmnefkrgeyrylvatdvaargidienislvinydlplekesyvhrtgr
tgragnkgkaisfvtafekrfladieeyigfeiqkiea

SCOPe Domain Coordinates for d2hjva_:

Click to download the PDB-style file with coordinates for d2hjva_.
(The format of our PDB-style files is described here.)

Timeline for d2hjva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hjvb_