SCOPe 2.05: Domain d2hjvb_: 2hjv B:

Lineage for d2hjvb_ (2hjv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [230763] (2 PDB entries)

8. Domain d2hjvb_: 2hjv B: [230764]
   automated match to d2rb4a_

Details for d2hjvb_

PDB Entry: 2hjv, 1.95 Å

PDB Description: Structure of the second domain (residues 207-368) of the Bacillus subtilis YxiN protein

PDB Compounds: (B:) ATP-dependent RNA helicase dbpA

SCOPe Domain Sequences for d2hjvb_:

Sequence; same for both SEQRES and ATOM records:

>d2hjvb_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
niehaviqvreenkfsllkdvlmtenpdsciifcrtkehvnqltdelddlgypcdkihgg
miqedrfdvmnefkrgeyrylvatdvaargidienislvinydlplekesyvhrtgrtgr
agnkgkaisfvtafekrfladieeyigfeiqkiea

Timeline for d2hjvb_:

• d2hjvb_ first appeared in SCOPe 2.03
  
• d2hjvb_ appears in SCOPe 2.04
  
• d2hjvb_ appears in SCOPe 2.06
  
• d2hjvb_ appears in the current release, SCOPe 2.08