Lineage for d2h8gb_ (2h8g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889239Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196600] (6 PDB entries)
  8. 2889241Domain d2h8gb_: 2h8g B: [230762]
    automated match to d3bsfb_
    complexed with ade

Details for d2h8gb_

PDB Entry: 2h8g (more details), 1.5 Å

PDB Description: 5'-Methylthioadenosine Nucleosidase from Arabidopsis thaliana
PDB Compounds: (B:) 5'-Methylthioadenosine Nucleosidase

SCOPe Domain Sequences for d2h8gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8gb_ c.56.2.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgrda
algidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdrri
pipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdmeg
aavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfingrn
lsdl

SCOPe Domain Coordinates for d2h8gb_:

Click to download the PDB-style file with coordinates for d2h8gb_.
(The format of our PDB-style files is described here.)

Timeline for d2h8gb_: