Lineage for d2h4vb1 (2h4v B:831-1122)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (116 PDB entries)
  8. 2116669Domain d2h4vb1: 2h4v B:831-1122 [230760]
    Other proteins in same PDB: d2h4va2, d2h4vb2
    automated match to d3qcea_
    complexed with act, cl, edo, flc, na

Details for d2h4vb1

PDB Entry: 2h4v (more details), 1.55 Å

PDB Description: Crystal Structure of the Human Tyrosine Receptor Phosphatase Gamma
PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase gamma

SCOPe Domain Sequences for d2h4vb1:

Sequence, based on SEQRES records: (download)

>d2h4vb1 c.45.1.0 (B:831-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhknryinilaydhsr
vklrplpgkdskhsdyinanyvdgynkakayiatqgplkstfedfwrmiweqntgiivmi
tnlvekgrrkcdqywptenseeygniivtlkstkihacytvrrfsirntkvkkgqkgnpk
grqnervviqyhytqwpdmgvpeyalpvltfvrrssaarmpetgpvlvhcsagvgrtgty
ividsmlqqikdkstvnvlgflkhirtqrnylvqteeqyifihdalleailg

Sequence, based on observed residues (ATOM records): (download)

>d2h4vb1 c.45.1.0 (B:831-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhknryinilaydhsr
vklrplpskhsdyinanyvdgynkakayiatqgplkstfedfwrmiweqntgiivmitnl
vekgrrkcdqywptenseeygniivtlkstkihacytvrrfsirntkvnervviqyhytq
wpdmgvpeyalpvltfvrrssaarmpetgpvlvhcsagvgrtgtyividsmlqqikdkst
vnvlgflkhirtqrnylvqteeqyifihdalleailg

SCOPe Domain Coordinates for d2h4vb1:

Click to download the PDB-style file with coordinates for d2h4vb1.
(The format of our PDB-style files is described here.)

Timeline for d2h4vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h4vb2