Lineage for d1as8b1 (1as8 B:4-166)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11202Protein Nitrite reductase, NIR [49551] (3 species)
  7. 11226Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (9 PDB entries)
  8. 11233Domain d1as8b1: 1as8 B:4-166 [23076]

Details for d1as8b1

PDB Entry: 1as8 (more details), 1.85 Å

PDB Description: structure of nitrite bound to reduced alcaligenes faecalis nitrite reductase at cryo temperature

SCOP Domain Sequences for d1as8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as8b1 b.6.1.3 (B:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOP Domain Coordinates for d1as8b1:

Click to download the PDB-style file with coordinates for d1as8b1.
(The format of our PDB-style files is described here.)

Timeline for d1as8b1: