Lineage for d2h0aa_ (2h0a A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144276Species Thermus thermophilus [TaxId:274] [230757] (1 PDB entry)
  8. 2144277Domain d2h0aa_: 2h0a A: [230758]
    automated match to d3tb6b_

Details for d2h0aa_

PDB Entry: 2h0a (more details), 2.8 Å

PDB Description: Crystal structure of probable Transcription regulator from Thermus thermophilus
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2h0aa_:

Sequence, based on SEQRES records: (download)

>d2h0aa_ c.93.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
tvsvllpfvatefyrrlvegiegvlleqrydlalfpilslarlkrylenttlayltdgli
lasydlterfeegrlpterpvvlvdaqnprydsvyldnrlggrlagaylarfpgpifaia
veeepdrafrrtvfaermagfqealkeagrpfspdrlyitrhsqeggrlalrhflekasp
plnvfagadqvalgvleeavrlgltpgrdvrvlgfdghpfaeeaglstiaqpveamgara
aqlllermrgyqgpprevrfepvlverastgtppaa

Sequence, based on observed residues (ATOM records): (download)

>d2h0aa_ c.93.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
tvsvllpfvatefyrrlvegiegvlleqrydlalfpilslarlkyltdglilasydltrl
pterpvvlvdaqnprydsvyldnrlggrlagaylarfpgpifaiaveeepdrrtvfaerm
agfqealkeagrpfspdrlyitrhsqeggrlalrhflekaspplnvfagadqvalgvlee
avrlgltpgrdvrvlgfdghpfaeeaglstiaqpveamgaraaqlllermrgyqgpprev
rfepvlverastgtppaa

SCOPe Domain Coordinates for d2h0aa_:

Click to download the PDB-style file with coordinates for d2h0aa_.
(The format of our PDB-style files is described here.)

Timeline for d2h0aa_: