SCOPe 2.07: Domain d2gzva1: 2gzv A:19-105

Lineage for d2gzva1 (2gzv A:19-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)

8. Domain d2gzva1: 2gzv A:19-105 [230756]
   Other proteins in same PDB: d2gzva2, d2gzva3
   automated match to d2fnec_

Details for d2gzva1

PDB Entry: 2gzv, 1.12 Å

PDB Description: the cystal structure of the pdz domain of human pick1

PDB Compounds: (A:) PRKCA-binding protein

SCOPe Domain Sequences for d2gzva1:

Sequence, based on SEQRES records:

>d2gzva1 b.36.1.0 (A:19-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpgkvtlqkdaqnligisigggaqycpclyivqvfdntpaaldgtvaagdeitgvngrsi
kgktkvevakmiqevkgevtihynklq

Sequence, based on observed residues (ATOM records):

>d2gzva1 b.36.1.0 (A:19-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpgkvtlqkdaqnligisigggaqpclyivqvfdntpaaldgtvaagdeitgvngrsikg
ktkvevakmiqevkgevtihynklq

Timeline for d2gzva1:

• d2gzva1 first appeared in SCOPe 2.03, called d2gzva_
  
• d2gzva1 appears in SCOPe 2.06