Lineage for d2gz6a_ (2gz6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004283Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2004284Protein automated matches [190108] (16 species)
    not a true protein
  7. 2004285Species Anabaena sp. [TaxId:360069] [230753] (1 PDB entry)
  8. 2004286Domain d2gz6a_: 2gz6 A: [230754]
    automated match to d3wkga_

Details for d2gz6a_

PDB Entry: 2gz6 (more details), 2 Å

PDB Description: Crystal Structure Of Anabaena sp. CH1 N-acetyl-D-glucosamine 2-epimerase At 2.0 A
PDB Compounds: (A:) N-acetyl-D-glucosamine 2-epimerase

SCOPe Domain Sequences for d2gz6a_:

Sequence, based on SEQRES records: (download)

>d2gz6a_ a.102.1.0 (A:) automated matches {Anabaena sp. [TaxId: 360069]}
knlqalaqlyknallndvlpfwenhsldseggyftcldrqgkvydtdkfiwlqnrqvwtf
smlcnqlekrenwlkiarngakflaqhgrddegnwyfaltrggeplvqpynifsdcfaam
afsqyalasgeewakdvamqaynnvlrrkdnpkgkytktypgtrpmkalavpmilanltl
emewllpqetlenvlaatvqevmgdfldqeqglmyenvapdgshidcfegrlinpghgie
amwfimdiarrkndsktinqavdvvlnilnfawdneygglyyfmdaaghppqqlewdqkl
wwvhleslvalamgyrltgrdacwawyqkmhdyswqhfadpeygewfgylnrrgevllnl
kggkwkgcfhvpramylcwqqfeals

Sequence, based on observed residues (ATOM records): (download)

>d2gz6a_ a.102.1.0 (A:) automated matches {Anabaena sp. [TaxId: 360069]}
knlqalaqlyknallndvlpfwenhsldseggyftcldrqgkvydtdkfiwlqnrqvwtf
smlcnqlekrenwlkiarngakflaqhgrddegnwyfaltrggeplvqpynifsdcfaam
afsqyalasgeewakdvamqaynnvlrrtrpmkalavpmilanltlemewllpqetlenv
laatvqevmgdfldqeqglmyenvapdgshidcfegrlinpghgieamwfimdiarrknd
sktinqavdvvlnilnfawdneygglyyfmdaaghppqqlewdqklwwvhleslvalamg
yrltgrdacwawyqkmhdyswqhfadpeygewfgylnrrgevllnlkggkwkgcfhvpra
mylcwqqfeals

SCOPe Domain Coordinates for d2gz6a_:

Click to download the PDB-style file with coordinates for d2gz6a_.
(The format of our PDB-style files is described here.)

Timeline for d2gz6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gz6b_