SCOPe 2.05: Domain d2gwwa2: 2gww A:129-258

Lineage for d2gwwa2 (2gww A:129-258)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein automated matches [226863] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)

8. Domain d2gwwa2: 2gww A:129-258 [230752]
   automated match to d1rkea2

Details for d2gwwa2

PDB Entry: 2gww, 2.72 Å

PDB Description: Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site (residues 602-633)

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d2gwwa2:

Sequence; same for both SEQRES and ATOM records:

>d2gwwa2 a.24.9.1 (A:129-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswdedaw

Timeline for d2gwwa2:

• d2gwwa2 first appeared in SCOPe 2.03
  
• d2gwwa2 appears in SCOPe 2.04
  
• d2gwwa2 appears in SCOPe 2.06
  
• d2gwwa2 appears in the current release, SCOPe 2.08