Lineage for d2gwwa1 (2gww A:1-128)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700163Protein automated matches [226863] (2 species)
    not a true protein
  7. 2700171Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)
  8. 2700177Domain d2gwwa1: 2gww A:1-128 [230751]
    Other proteins in same PDB: d2gwwa3
    automated match to d1syqa1

Details for d2gwwa1

PDB Entry: 2gww (more details), 2.72 Å

PDB Description: Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site (residues 602-633)
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d2gwwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwwa1 a.24.9.1 (A:1-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgke
tvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgts
dllltfde

SCOPe Domain Coordinates for d2gwwa1:

Click to download the PDB-style file with coordinates for d2gwwa1.
(The format of our PDB-style files is described here.)

Timeline for d2gwwa1: