Lineage for d2ghib_ (2ghi B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114597Species Plasmodium yoelii [TaxId:352914] [225071] (1 PDB entry)
  8. 2114599Domain d2ghib_: 2ghi B: [230748]
    automated match to d2ghid_
    complexed with so4

Details for d2ghib_

PDB Entry: 2ghi (more details), 2.2 Å

PDB Description: crystal structure of plasmodium yoelii multidrug resistance protein 2
PDB Compounds: (B:) transport protein

SCOPe Domain Sequences for d2ghib_:

Sequence, based on SEQRES records: (download)

>d2ghib_ c.37.1.0 (B:) automated matches {Plasmodium yoelii [TaxId: 352914]}
lesfsltshekkfgvniefsdvnfsypkqtnhrtlksinffipsgttcalvghtgsgkst
iakllyrfydaegdikiggknvnkynrnsirsiigivpqdtilfnetikynilygkldat
deevikatksaqlydfiealpkkwdtivgnkgmklsggerqriaiarcllkdpkivifde
atssldskteylfqkavedlrknrtliiiahrlstissaesiillnkgkivekgthkdll
klngeyaemwnmq

Sequence, based on observed residues (ATOM records): (download)

>d2ghib_ c.37.1.0 (B:) automated matches {Plasmodium yoelii [TaxId: 352914]}
lesfsltshekkfgvniefsdvnfsypkqtnhrtlksinffipsgttcalvghtgsgkst
iakllyrfydaegdikiggknvnkynrnsirsiigivpqdtilfnetikynilygkldat
deevikatksaqlydfiealpkkwdtivgnkmklsggerqriaiarcllkdpkivifdea
tsdskteylfqkavedlrknrtliiiahrtissaesiillnkgkivekgthkdllklnge
yaemwnmq

SCOPe Domain Coordinates for d2ghib_:

Click to download the PDB-style file with coordinates for d2ghib_.
(The format of our PDB-style files is described here.)

Timeline for d2ghib_: